SKU: 1571584626

IL10RB Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL10RB Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CDw210B, CRF2 4, CRFB4, CRFB4, D21S58, D21S66, IBD25, IL 10R2 Accession Q08334 Amino Acid Sequence Met20 Ser220, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms CDw210B, CRF2-4, CRFB4, CRFB4, D21S58, D21S66, IBD25, IL-10R2
Accession Q08334
Amino Acid Sequence

Met20-Ser220, with C-terminal Human IgG Fc MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Lutfalla, G. et al. (1993) Genomics 16:366. 2. Xie, M.-H. et al. (2000) J. Biol. Chem. 275:31335. 3. Kotenko, S.V. et al. (2003) Nat. Immunol. 4:69. 4. Yoon, S.I. et al. (2006) J. Biol. Chem. 281:35088.

Background

Interleukin 10 receptor, beta subunit (IL10RB/IL-10RB) also known as Cytokine receptor family 2 member 4, Interleukin-10 receptor subunit 2, and cytokine receptor family II, member 4, is a subunit for the interleukin-10 receptor. Some members of the IL-10 family are monomeric cytokines and interact with single molecules of IL-10 R beta and their ligand‑specific subunit. Mature human IL-10 R beta consists of a 201 amino acid (aa) extracellular region with two fibronectin type-III domains, a 22 aa transmembrane segment and a 83 aa cytoplasmic domain. IL‑10 R beta is widely expressed, while the associated receptor subunits exhibit differential expression patterns. The ligand‑specific subunits are responsible for the divergent functions of these cytokines, encompassing immune suppression, promotion or inhibition of inflammation, mucosal defense, antiviral immunity, and hematopoiesis. IL-10 R beta deficient mice lack responsiveness to each of those cytokines. IL-10 R beta contributes to ligand binding, but effective signaling is only triggered in the presence of the ligand‑specific subunit. In the case of IL-10, a cytokine dimer binds to two IL‑10 R alpha /IL-10R1 chains, resulting in recruitment of two IL-10 R beta /IL-10R2 chains.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1571584626

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Carlos Andrade
Fort Morgan, US
★★★★★ 5
Todo según lo esperado
Color: Dark Brown
Todo como lo esperado
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
J
Verified Purchase
James Turner
Lake Worth, US
★★★★★ 5
Great for blue collar guys
Color: Dark Brown
Perfect size for dumping pockets, phone, knife and keys after work or when switching pants
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
J
Verified Purchase
Jessica
Cuba, US
★★★★★ 5
Quality Product, Definitely Recommend
Size: 17.2"L x 3.15"W x 0.78"H, Color: Black Walnut, Size: 17.2"L x 3.15"W x 0.78"H, Color: Black Walnut
Looks and feels great. Amazingly smooth, and well-crafted. It fits the length of my keyboard, and has quality grippers on the base to prevent sliding. Was actually really pleased with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 15, 2025
J
JCF
Omaha, US
★★★★★ 5
High quality solid wood rest
Size: 14.4"L x 3.15"W x 0.78"H, Color: Black Walnut
This wrist rest is nicely finished and was well packed in high-density foam as well as a cardboard box that was wrapped very tightly in thick plastic. It's sanded very, very smooth and is made of beautiful solid walnut, with nonskid pads on the back. The branding is on the side that touches the keyboard, so it is not visible or obtrusive at all. My keyboard is 15.5 inches long, and the 14.4 inch rest looks great up against it. The 0.78" thickness is also very suitable for the thickness of my keyboard. The product gets 5 stars because it is accurately represented and this is entirely down to personal preference, but something about this rest that I don't love is the degree of incline. I have my keyboard up on the kickstands, and the wrist rest that I already owned slopes pretty dramatically starting from the middle, so it follows the angle of the keyboard. The ZQL wrist rest is about 75% flat and then has a small slope that rounds off on the bottom edge. Again, this is very much a personal thing; I just brought it up because it's something that people might not think too much about until they actually use it. I think this rest would be great for anyone with very large hands, or with a flat keyboard. It's taking a little getting used to for me, but I really enjoy the smoothness and obvious quality of the wood. A wrist rest is an ergonomic must when it comes to thicker keyboards.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 28, 2025
M
Mr. Johnson
Pawtucket, US
★★★★★ 5
Nice. I like that the wood feels cool to the touch
Size: 14.4"L x 3.15"W x 0.78"H, Color: Black Walnut, Size: 14.4"L x 3.15"W x 0.78"H, Color: Black Walnut
A nice little wooden wrist rest. I would suggest not using it as a wrist rest, but use it more as a palm rest, because if you are having pain, putting more pressure on those wrist tendons is not gonna help. Quality of the item is good. My biggest worry about wooden wrist rests is that they'll not be sanded well, or not smooth, and you'll get a sliver or catch your skin on a piece. Second biggest worry is that they will be slippery, and slide around the desk, or just be covered with a coating or finish that is sticky for human skin. I'm happy to say, that this didn't have those issues. Mine is smooth, and made of dense wood. It doesn't feel cheap and made with hollow wood. There are no burs or slivers. It's not lacquered or sticky for your hands. It doesn't stain my hands when in use. And it has rubber feet to help grip, so it doesn't slide around. One benefit to having a wood wrist rest, is that it stays "cool" to the touch longer than cloth or gel pads. But, at the same time, one heated, it takes longer to cool back down. I've found that I quite like the cool sensation that is unique to wood. I'm happy with it and the overall quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025

recommand products