SKU: 16093208175

Human ApoE2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ApoE2 Protein, His TagProduct Specification Species Human Synonyms Apolipoprotein E, Apo E, APOE Accession P02649 Amino Acid Sequence Protein sequence (P02649, Lys19 His317(Arg176Cys), with C His Tag)

Product Specification


Species Human
Synonyms Apolipoprotein E, Apo-E, APOE
Accession P02649
Amino Acid Sequence

Protein sequence (P02649, Lys19-His317(Arg176Cys), with C-His Tag) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Expression System HEK293
Molecular Weight Predicted MW: 35.9 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, pH8.0 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The APOE2 protein is one of three major isoforms (E2, E3, E4) of apolipoprotein E (APOE), a key lipid transport protein involved in cholesterol metabolism and neuronal repair. Encoded by the APOE gene, APOE2 differs from the most common isoform (APOE3) by a cysteine-for-arginine substitution at position 158 (Cys158Arg), altering its structure and receptor-binding affinity. While APOE2 is associated with a reduced risk of late-onset Alzheimer’s disease (AD) compared to APOE4, homozygous carriers may develop type III hyperlipoproteinemia, a lipid disorder. APOE2 exhibits weaker binding to LDL receptors, impairing clearance of triglyceride-rich lipoproteins. Its neuroprotective effects in AD may stem from enhanced amyloid-β clearance and anti-inflammatory properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16093208175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kylie R.
Natrona Heights, US
★★★★★ 5
Comfortable, Breathable, and Worth Every Penny!
Size: King (104" X 90"), Color: 09 - Iceberg Green (No Comforter), Size: King (104" X 90"), Color: 09 - Iceberg Green (No Comforter)
I decided to switch from synthetic bedding to 100% cotton, and I am SO glad I did. The quality of this set is amazing. I washed everything before using it, and it washed well overall. There were a few small cotton fuzzies after washing, but nothing a quick lint roll couldn’t fix. I ordered the sage green duvet cover and pillowcases, and the color is beautiful. In bright morning light it looks more like a true sage green, while in dimmer lighting it can lean more earthy or military green. Either way, it’s stunning, cozy, and really warms up the room. The biggest difference for me was the sleep quality. I normally wake up several times a night and overheat easily, but the first night sleeping with this duvet cover and my new 100% cotton sheets, I slept completely through the night without waking up once. The cotton feels slightly heavier in the best way -- cozy and tucked in without feeling hot or suffocating. It was truly the best night's sleep I have gotten in a very long time. I honestly didn’t realize how much fabric type could affect sleep quality until now. My body responded so well to the cotton that I don’t think I can ever go back to synthetic bedding again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
E
Verified Purchase
Emily
Phoenix, US
★★★★★ 4
Color is off
Size: King (104" X 90"), Color: 15 - Petal Pink (No Comforter)
I ordered the petal pink, but the color is brighter and more peach colored than pictured. Besides that, it's super soft, easy to use and comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
C
Verified Purchase
CRAYNA
San Leandro, US
★★★★★ 5
Zipper + Ultra-Soft Cotton = Love this Duvet Cover
Size: Queen (90" X 90"), Color: 01 - Natural White (No Comforter)
I just received this duvet and I couldn’t be happier. Right out of the packaging, the first thing I noticed was how incredibly soft the fabric felt—no stiffness or “breaking in” period needed. It has that cozy, breathable cotton feel that makes climbing into bed even more inviting. One feature I especially appreciate is the zipper closure at the bottom. It makes inserting and removing the duvet so much easier compared to traditional button closures, and it keeps everything securely in place without any gaps. The overall quality feels great, from the stitching to the fabric itself. It’s lightweight yet still feels durable, and it adds a clean, comfortable look to my bed. The one thing I would suggest is make sure you select the right "white" color. There's a bright white that I am going to order as the white I ordered "Natural" has a bit of a tan color in it against a bright white.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
T
Verified Purchase
Tammy
Grantham, US
★★★★★ 5
Clean crisp and easy to put on.
Size: King (104" X 90"), Color: 01 - Natural White (No Comforter)
Great price point for a 100% cotton duvet. Washes and dries well and the white is clean and crisp. I love the zipper closure and the corner ties. Very easy to put on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
R
Verified Purchase
Rachel W.
Draper, US
★★★★★ 5
Hotel-Quality Bedding Without the Price Tag
Size: Queen (90" X 90"), Color: 01 - Natural White (No Comforter)
I recently refreshed my second bedroom and needed new bedding, and this duvet cover came recommended by a friend who’s an interior designer for hotels—so my expectations were high. It absolutely delivered. The fabric is incredibly soft and comfortable, and it instantly gave the room that clean, neutral, fresh look I was going for. It truly looks high-end and elevated, but without the high-end price, which was a huge win. I’ve already shared the link with friends and family because it’s just that good. If you’re looking to upgrade your space without breaking the bank, this is a no-brainer. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026

recommand products