SKU: 22079959520

Human Jagged1, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 15 - Jul 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Jagged1, His tagProduct Specification Species Human Synonyms hJ1, CD339, JAG1, JAGL1 Accession P78504 Amino Acid Sequence Protein sequence (P78504, Ser32 Ile335, with C 10*His)

Product Specification


Species Human
Synonyms hJ1, CD339, JAG1, JAGL1
Accession P78504
Amino Acid Sequence

Protein sequence (P78504, Ser32-Ile335, with C-10*His) SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 35.4 kDa Observed MW: 44 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Jagged1 (JAG1) is one of five cell surface proteins (ligands) that interact with four receptors in the mammalian Notch signaling pathway. The Notch Signaling Pathway is a highly conserved pathway that functions to establish and regulate cell fate decisions in many organ systems. Once the JAG1-NOTCH (receptor-ligand) interactions take place, a cascade of proteolytic cleavages is triggered resulting in activation of the transcription for downstream target genes. JAG1 gene is expressed in multiple organ systems in the body and causes the autosomal dominant disorder Alagille syndrome (ALGS) resulting from loss of function mutations within the gene. ALGS is an autosomal dominant multi-system disorder affecting several body systems including the liver, heart, skeleton, eye, facial structure, kidneys and vascular system. JAG1 expression changes have been implicated in many types of cancer. Up regulation of JAG1 has been correlated with both poor overall breast cancer survival rates and an enhancement of tumor proliferation in adrenocortical carcinoma patients.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22079959520

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 305 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gretel Fernandez
Carnegie, US
★★★★★ 5
Pro-Level Speed & Precision in One Mouse 🎮⚡
This mouse is absolutely amazing. The Logitech G PRO X2 SUPERSTRIKE is incredibly lightweight, fast, and precise. You can feel the difference immediately, especially in competitive games where every movement matters. The clicks are super responsive and customizable, which gives you better control during gameplay. The sensor is extremely accurate with no lag at all. Battery life is excellent, and the USB-C charging makes it very convenient. Overall, it feels like a premium, pro-level gaming mouse. If you’re serious about performance, this is definitely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
M
Verified Purchase
Murat Denisultanov
Draper, US
★★★★★ 5
Super lightweight and smooth for gaming
Really enjoying this mouse so far. It feels super light in the hand and moves very smoothly while gaming. The clicks are responsive, and the wireless connection has been stable with no lag issues. Battery life also seems pretty good. The shape is comfortable even during longer sessions. The only thing I would improve is adding a little more grip texture on the sides, but overall it’s an excellent gaming mouse.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
Alex
San Leandro, US
★★★★★ 4
Really great mouse, but terrible skates.
I absolutely loves this mouse. I usually have stuck to only using razer mice in the past. However I made the switch to this one and its honestly so great. I only really have one complaint and the rest is amazing. Pros: Battery life is honestly amazing. Its really quiet because it no longer clicks, its just haptic feedback like the ps5 controller. You can adjust when it actually clicks which is super cool just like a Hall effect keyboard, because it's the same tech. Mouse just feels great and the included grips are nice, but they do take some getting used to as they aren't what I was expecting. However I have come to like them. Cons: It's vey expensive for a mouse, there's a lot of competition and a variety of mice esp way cheaper. The stock skates are absolutely terrible, that's why I changed them jade's and now its perfect. No complaints after that. However for a mouse this expensive, I was hoping for better skates. I also don't really like the scroll wheel, to be fair I do come from razer mice so that might be why I hate it. It also takes some getting used to as the mouse is front heavy because of the switches on the mouse, but I bet you can fix that if you have a powerplay to balance it out. However I have this mouse for 2 months now and I absolutely love it and I wouldn't switch for another. The only thing I would change if you were buying this mouse today is to also order skates so you can replace them. Would be a 5/5 if it weren't for the terrible skates. TL;DR: Great mouse if purchasing, buy skates as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
B
Verified Purchase
Bryan
Battle Creek, US
★★★★★ 5
Huge Upgrade!!!
After just a week of using this mouse, I can confidently say this is the best peripheral purchase I have ever made. I initially wasn't in the market for a new mouse, until my scroll wheel broke on my razer mouse. I decided to just pull the trigger on the X2 Superstrike instead of purchasing another razer mouse. The mouse material feel is excellent, and the wheel is great as well. I've also seen some reviews disliking the skates on the X2 Superstrike, however I personally found them to be great. The haptic feedback mouse click seemed a bit gimmicky before I actually used it. Right off the bat, the mouse click feels incredibly responsive and similar to that of any high quality mouse. You get enough feedback and it doesn't feel that much different from a regular mouse click. But, you also have optionality to adjust a ton of settings, like accuation, feedback strength, etc. For gaming, with the right settings, this genuinely feels amazing, and that's before the performance upgrade. As many other reviewers have noted, it noticeably decreases latency on top of all of this. Another huge perk with this mouse I found, was that it's almost dead silent as well. No more loud clicking! My only critique with the mouse are the side buttons and the size. The side buttons are the only part of the mouse that feel "cheap". Because I use the side buttons often in competitive games, I notice it a lot more than probably most people would. I also have large hands, and this is the smallest mouse I have used. I got used to it pretty quick, but the mouse is on the smaller side. Nonetheless, if you are looking to upgrade your mouse and have the money, I would 100% recommend. This feels as impactful as going from a 60hz monitor to a 144hz+.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
Verified Purchase
Anna
Bozeman, US
★★★★★ 5
Works so well I got a second one!
Size: One Size
I rarely write reviews but I came here specifically because this mouse is great! As someone who is technologically challenged I appreciate everything about it-- I bought one of these 5 years ago and use it heavily everyday, it still works like a dream which is why I bought a second one to use on a separate computer. Started using this new one and it was just as easy to set up as the first one, just plugged in the USB piece and was able to use it immediately, no further setup required. As a bonus, it already came with batteries like the last one did (by the way I never turn off my 5 year old mouse and the same batteries are still in it working great). Smooth operation, ergonomic, easy to use, and portable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026

recommand products