SKU: 27189032023

BCMA/TNFRSF17 His Tag Protein, Mouse

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BCMA/TNFRSF17 His Tag Protein, MouseProduct Specification Species Mouse Synonyms TNFRSF17, CD269, BCM Accession O88472 1 Amino Acid Sequence Met1 Thr49, with C terminal 10*His MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTGGGSGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 12 17kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at 0. 1 1 mg ml

Product Specification


Species Mouse
Synonyms TNFRSF17, CD269, BCM
Accession O88472-1
Amino Acid Sequence

Met1-Thr49, with C-terminal 10*His MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 12-17kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Gene ID: 608, updated on 18-Aug-2023.

Background

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. TNFRSF17 is expressed in mature B-cells, but not in T-cells or monocytes. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27189032023

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
DaveC
Grantham, US
★★★★★ 5
Exfoliating, durable, helps bars of soap last much longer.
Style: Sport
Am very happy with the convenience and longevity of this product. In addition the exfoliating properties they really do help make my bars of (sometimes quit expensive) soap in the shower last a lot longer - as much as 3 to 5 times as long. I simply hang it up or place on a shower caddy after rinsing the excess suds off and no more soft, soggy bars of leftover soap laying around. Having tried many different versions of these and I find this style is the easiest to get to properly hold onto any odd shaped or larger bars of soap without the soap accidentally popping out in the shower during use. They also seem to outlast many of the other soap savers. They don’t unexpectedly start unraveling after just a few uses like some of the bath poufs tend to do.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
D
Verified Purchase
D Leigh
Carnegie, US
★★★★★ 4
Really good, however, a drawstring to keep the soap inside would be amazing
Style: Sport
I bought these sport soap saver bags and I really enjoy them. I exfoliate with loofah all the time so I did not find the grit of this soap saver bag too abrasive. I found it perfect. I washed and lathered all my parts no problem. I had a half gone bar of soap I put inside upon receiving these bags, and the lather was amazing. The soap did move around the smallest little bit because it was smaller. I assume with a brand new bar soap It’s much easier to use. But that happens with all of these same design products. A drawstring at the end of the soap saver bag would make this five stars all day. I would definitely buy these again based on the quality and exfoliation level.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 18, 2025
S
Verified Purchase
Sam
Pawtucket, US
★★★★★ 5
Great exfoliant!
Style: Sport
Great scrubber!! Definitely comes in handy during the cold months to help deep exfoliate where you need it most.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
G
Verified Purchase
gas
Port Orchard, US
★★★★★ 5
well-made and should not fall apart as others have.
Style: Sport
Works great. Seems rough but after the first use it softens.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
I
Verified Purchase
Israel Quinones
Alexandria, US
★★★★★ 5
Excellent pouch.
Style: Sport
Pouch is excellent for preserving soap and avoiding mess.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026

recommand products