SKU: 31637793289

Human papillomavirus type 16 E7

Sale price$99.00 Regular price$110.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 14 - Jul 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7Product Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression System E.coli
Molecular Weight Predicted MW: 11.0 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. HPV E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31637793289

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 2192 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Courtney
Bozeman, US
★★★★★ 5
Incredible!
This product is absolutely insane! My skin has been sensitive oily dry mix with ance and blemishs. I even see a dermatologist. This product has healed my skin. My ance is gone and my skin is now soft and the blemishes, dark, ans dull spots are fading. I would highly recommend trying this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
F
Verified Purchase
FlanJK
Los Angeles, US
★★★★★ 5
Love this stuff!
Decided to give this a shot after watching one of my favorite influencers always raving about it for acne-prone, rosacea, sensitive skin people! I couldn’t be happier with it. I’m absolutely going to be reordering. It’s cooling, absorbs nicely, and my skin LOVES it! This product does not irritate my super sensitive skin, it’s a high quality product. I use this with the cleanser and the pro-bio serum both from skin 1004. They’ve all became staples in my skincare routine. Love the ingredients in these products, they’re so calming and soothing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
C
Verified Purchase
Chloe
Charlottesville, US
★★★★★ 5
Great moisturizer!
Purchased this item after watching a tiktok about it and so far i love it! Leaves the skin feeling very soft and moisturized, not greasy and thick. I have sensitive skin and I love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
Sabrina Luna
Whiting, US
★★★★★ 4
Day Moisturizer
I am very dry, this makes a great morning moisturizer. For the evening I do need something heavier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
E
Verified Purchase
Ekaterina
Draper, US
★★★★★ 5
Great product for oily skin
Great cream. I have a sensitive/oily skin, it work so well for me! Lightweight yet moisturizing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products