SKU: 33882524337

Human papillomavirus type 16 E7

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7Product Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression System E.coli
Molecular Weight Predicted MW: 11.0 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. HPV E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33882524337

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Alley Cat on a Homestead
Waukegan, US
★★★★★ 5
Excellent Quality, Great Value, Great Look. Highly Recommend
Very well-made, there are some minor imperfections in the cuff sewing that aren't really noticeable when on. Liner is quality, color is spot on, and it fits true to size. If you're in the market for a toddler blazer and pants, you can't go wrong with this one in terms of quality, price, and the cut is perfect for a very polished look. There were a few loose strings to be clipped, but everything was correctly sewn and well. None of them affected the seam strength. The pants have a button and elastic on the waistband to make adjusting the waist size easier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2025
A
Amazon Customer
Fort Morgan, US
★★★★★ 5
Great boys slim fit suit for weddings, church, or special events
Color: Medium Grey, Size: 12
Great kids suit. Comes with a jacket, pants, and tie. Does not have a shirt. Fits as expected. Classic cut on the lapels. Great quality materials. Well made pants and jacket. The color is consistent without any fade or dark spots that can happen with lower quality fabrics. Looks great on. My son loves it. Says it is not restrictive, he can move easily in it. Highly recommend for church, special events, weddings, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 22, 2025
M
Mommynificent
Phoenix, US
★★★★★ 5
Nice high-quality, light weight suit for a tween!
Color: Navy Blue, Size: 10
This is such an attractive suit for a tween boy! My son loves dressing up, and this is his new favorite suit. He really likes the double-breasted style and the light weight of the fabric so that it isn't too hot. The tie that came with it gives major Harry Potter vibes which we weren't expecting, but he has lots of other ties that he also enjoys pairing with it. The size seems right, and it fits him well. He says it is very comfortable. I'm happy with the quality and the navy color.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2025
A
A. Beauto
Fort Morgan, US
★★★★★ 5
Stylish and great value!
Color: Medium Grey, Size: 14
This grey suit was a great find for a school ceremony and will definitely be used again. The neutral color makes it easy to pair with different shirts and ties, and it has a modern, clean-cut look. The jacket and pants fit nicely after a quick press, and the quality was better than I expected for the price. It lost a star only because the waist on the pants needed a slight adjustment, but overall, we’re very happy with it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2025
N
N. Hale
Birmingham, US
★★★★★ 3
Runs big, and fabric may not be same color as picture
Color: Medium Grey, Size: 16, Color: Medium Grey, Size: 16
This suit was a good find for us, as we usually dress up for church, and my 13 yo son often wears suits. He normally wears a size 16, so that’s what we ordered, and in dark charcoal gray. The suit we got was a light, heathered gray that didn’t look much like the one in the picture. It was very wrinkly and thin, and a little scratchy. Also, the sleeves were way too long and the torso cut of the jacket was pretty wide. The pants were very large in the waist, but fit him decently in the length (he’s 5’4” and weighs 90 lbs). Overall the suit looked like it was drowning him, so I would order a size down unless you have a larger child/teen. Because of the ill fit, I haven’t had the chance to see what the suit looks like on him as it’s supposed to, but I guess I’ll return it or wait a year or two until he fills it out a bit more. Not overly impressed with the quality, so I’m not sure I’d pay $55 for this one again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025

recommand products