SKU: 66107966938

LAG-3 GST Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAG-3 GST Tag Protein, HumanProduct Specification Species Human Antigen LAG 3 Synonyms LAG 3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG 3 Accession P18627 Amino Acid Sequence Leu23 Leu450, with N terminal GST Tag

Product Specification


Species Human
Antigen LAG-3
Synonyms LAG-3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG-3
Accession P18627
Amino Acid Sequence

Leu23-Leu450, with N-terminal GST Tag

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSDDDDKLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL


Expression System HEK293
Molecular Weight 75-80kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Colin G. Graydon, Shifa Mohideen and Keith R.Fowke, LAG3’s Enigmatic Mechanism of Action. Frontiers in Immunology

Background

LAG3 is a member of the immunoglobulin superfamily and a CD4 ancestral homolog, resulting from a gene duplication event. Like CD4, LAG3 binds MHC class II (MHCII), but also FGL-1,α-synuclein fibrils (α-syn) and the lectins galectin-3 (Gal-3) and lymph node sinusoidal endothelial cell C-type lectin (LSECtin). As an immune checkpoint, LAG3 inhibits the activation of its host cell and generally promotes a more suppressive immune response. On T cells, LAG3 reduces cytokine and granzyme production and proliferation while encouraging differentiation into T regulatory cells.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66107966938

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Madelyn Griffith-Haynie
Houston, US
★★★★★ 5
My Shih Tzu goes crazy for these!!!
Pattern Name: Ring, Size: 0.42 Ounce (Pack of 4)
My guy’s favorite treat. He sticks his nose on the bag and can barely wait for me to get it open. Doesn’t upset his digestion. Have ordered multiple times and will continue to do so.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
S
Verified Purchase
Sherry
Port Orchard, US
★★★★★ 5
Dog friendly
Pattern Name: Lollipop, Size: 0.53 Ounce (Pack of 4)
My chihuahua loves these chicken tender lollipops
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
B
Verified Purchase
Brian Nowell
Houston, US
★★★★★ 3
🤷🏻‍♂️
Pattern Name: Lollipop, Size: 0.53 Ounce (Pack of 4)
Need to make sure you are supervising your dog. With in minutes my small terrier had the stick end down her throat with the whole ring end in her mouth. Had to hold the stick end and let her chew on the ring end. Lasted about 20 minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
T
Verified Purchase
594 Tuff
Belleville, US
★★★★★ 5
Favorite treat of all time for our Maltese pup.
Pattern Name: Lollipop, Size: 0.53 Ounce (Pack of 4)
These are my Maltese dog’s favorite treat. I don’t know if it is the whole combination of shape, taster, tendon location, or that they are from a Turkey, but they are an absolute winner when we have them. Since they are quite expensive, we only get them on occasion. If they were less expensive, even by 10%, I would justify regular purchases of them to myself. I highly recommend them for any size, breed, or reason. They are an exceptionally wonderful treat for my pup. I think I have just found the reason for ordering another order of these Turkey Tendon lollipops for my best friend. Especially since he eats them quite quickly, even though he is only four pounds. And they seem to be quite digestible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
J
Verified Purchase
J. Barry
Pawtucket, US
★★★★★ 5
Perfect treat for my Dolcé!
Pattern Name: Bone, Size: 0.53 Ounce (Pack of 4)
My 14 pound Maltipoo LOVES these. It keeps her occupied for a good 30 minutes. Be sure to get the bone-shaped ones because little dogs will choke on the lollipop-shaped ones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026

recommand products