SKU: 70218440299

Human CXCL9/MIG, His tag

Sale price$105.75 Regular price$117.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 14 - Jul 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CXCL9/MIG, His tagProduct Specification Species Human Synonyms Gamma interferon induced monokine, Monokine induced by interferon gamma (HuMIG; MIG), Small inducible cytokine B9, CMK, MIG, SCYB9 Accession Q07325 Amino Acid Sequence Protein sequence (Q07325, Thr23 Thr125, with C 10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa

Product Specification


Species Human
Synonyms Gamma-interferon-induced monokine, Monokine induced by interferon-gamma (HuMIG; MIG), Small-inducible cytokine B9, CMK, MIG, SCYB9
Accession Q07325
Amino Acid Sequence

Protein sequence (Q07325, Thr23-Thr125, with C-10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 16, 17, 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as monokine induced by gamma interferon (MIG). The CXCL9 is one of the chemokine which plays role to induce chemotaxis, promote differentiation and multiplication of leukocytes, and cause tissue extravasation. The CXCL9/CXCR3 receptor regulates immune cell migration, differentiation, and activation. Immune reactivity occurs through recruitment of immune cells, such as cytotoxic lymphocytes (CTLs), natural killer (NK) cells, NKT cells, and macrophages. Th1 polarization also activates the immune cells in response to IFN-γ. Tumor-infiltrating lymphocytes are a key for clinical outcomes and prediction of the response to checkpoint inhibitors. In vivo studies suggest the axis plays a tumorigenic role by increasing tumor proliferation and metastasis. CXCL9 predominantly mediates lymphocytic infiltration to the focal sites and suppresses tumor growth. It is closely related to two other CXC chemokines called CXCL10 and CXCL11. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70218440299

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1961 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
We3Kings
West Palm Beach, US
★★★★★ 5
Freaking Fantastic!!
Format: Kindle
First book like this I have read and I am hopping for the next to be soon! An amazing read and one personally I wouldn’t mind seeing as a movie!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2024
A
Albert Matt
Belleville, US
★★★★★ 5
Amazing and Great
Format: Kindle
I love this book so much it's amazing and wonderful! I can't wait for more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2024
J
Juniper Sanchez
Birmingham, US
★★★★★ 5
Amazing!
Format: Kindle
This book has everything, friendship, love, hot women, trans euphoria. I absolutely loved it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2024
I
Verified Purchase
Issy W
West Palm Beach, US
★★★★★ 5
wonderful trans sapphic shifter romance
Format: Kindle
When life falls apart, perhaps taking a break is just what is needed. But when Natalie (said trans woman) and Wren (loner alpha wolf) first see each other, it seems that perhaps that there might be something between them, but that just makes everything a lot more complicated. After all, a bond between a human and a wolf isn't a thing, is it? This was a wonderful read and I absolutely loved this story. Yes, while I may have a strong like of shifter stories, that also means that I also have expectations, and this story most definitely exceeded them. The trans representation was great. Natalie's struggles for acceptance, both internal and external resonating, and the difficulties that she's been through definitely resonate and are far too common of trans people. She's not a strong confident lead, but a woman who has issues and who does need the help and strength of others. She leans on others for better or for worse, but that makes her more real, and seeing her grow and become more confident as the story progresses is heart warming and wonderful. And the development of the bond - very nice! Wren is just as much a flawed character, with what's she's been through, and the knowing of the knowledge that she lacks. She starts off strong, as one would expect from a werewolf, but she also grows, becoming more than what she was in the beginning as well. For all of the angst and mistakes that are made, this is a story of growth and acceptance, of being able to gain what you actually desire, and to be able to embrace the support of others, knowing that you aren't alone in the world. It is a tale of finding love, of having a bond form, and being able to take it to the next level. This really is a wonderful sapphic shifter story, and one that I would highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2023
L
Verified Purchase
Loek
West Palm Beach, US
★★★★★ 4
Wow!
Format: Kindle
Natalie desperately needs a change to get over her messy breakup. Wren is a lone wolf. She is an Alpha and has no pack to run with. With so many things at stake, will their affair end in disaster or have they found what they’ve been looking for? I loved this fresh take on shifters with the variety of shapeshifters, the dangerous hunt and the great romance. It made this story a fantastic read and an emotional rollercoaster.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2023

recommand products