SKU: 72613669795

Human 14-3-3 zeta, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 14 - Jul 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human 14-3-3 zeta, His tagProduct Specification Species Human Synonyms Protein kinase C inhibitor protein 1 (KCIP 1) Accession P63104 Amino Acid Sequence Protein sequence (P63104, Met1 Asn245, with C 10*His) MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGENGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Protein kinase C inhibitor protein 1 (KCIP-1)
Accession P63104
Amino Acid Sequence

Protein sequence (P63104, Met1-Asn245, with C-10*His) MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGENGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 29.4 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein zeta/delta (14-3-3ζ) is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. The protein is a member of the 14-3-3 protein family and a central hub protein for many signal transduction pathways. 14-3-3ζ functions to protect the cell from environmental stresses, such as chemotherapy-induced death, anoikis, growth factor deprivation, and hypoxia. 14-3-3ζ plays a central role in cell proliferation and, by extension, tumor progression. The protein has been implicated in many cancers, including lung cancer, breast cancer, lymphoma, and head and neck cancer, through pathways such as mTOR, Akt, and glucose receptor trafficking. It has been associated with chemoresistance and is a promising therapeutic target for cancer treatment. It stands to become a prognostic marker for breast cancer, lung cancer, head and neck cancer, and possibly gastric cancer in patients who might require more aggressive treatment. 14-3-3ζ has been implicated in pathogenic infections and neurodegenerative diseases, including Creutzfeldt–Jakob disease, Parkinson’s disease, and Alzheimer’s disease (AD). Furthermore, recent studies have shown the 14-3-3ζ plays a significant clinical role in the suppression of the RA symptoms in experimental animals.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72613669795

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 505 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
M. Weber
Grantham, US
★★★★★ 5
Tried + tested on Caribbean vacation
Size: 6 Fl Oz (Pack of 1)
First let me start by saying I have an inflammatory condition so I needed a sunscreen that didn’t contribute to making my symptoms worse like many of the other sunscreens with harsh chemicals. This sunscreen is phenomenal! We just got back from a week in the Caribbean sun in Antigua/Barbuda, and I did not burn once! But there are some key things you must know before buying so that you can apply it properly and get the best protection. First, you must shake the can for about 20 seconds before each use. This way it mixes the sunscreen and applies it correctly. If you spray it and it comes out clear you have not shaken it up enough. It should spray solid white. Second, rub it in quickly after you spray it because it dries fast. Note that this does leave a white cast, but it’s not as bad as everyone says. I have light olive skin (half Hispanic, half white) and I tan easily but I also burn easily. When I applied it, it went on white but I just took the time and rub it in really well. The white cast will fade a little once it dries but it will also sit on top of the skin which is helpful to know when you need to re-apply. I applied in the morning about 20 min before getting in the sun. *Apply before putting on your swim suit! If it gets on your swimwear, it will leave white marks*. The sunscreen stayed on through pool and ocean use without rubbing off. I only needed to reapply on the tops of my shoulders once in the afternoon. Also, this is not to say that you won’t burn. While I was in the intense sun, I also spent time in the shade throughout the day just to make sure I was giving my skin breaks from the heat. But for being in the sun like I was, I am VERY impressed with this sunscreen. And for it only being spf 30, it protected me better than expected in the harsh Caribbean sun. I usually come home from vacations with a little burn but absolutely none this time! Just be sure to take time to apply it correctly and you should be good! I’d rather have a slight, minimal white cast than be burnt and miserable. It’s worth it! I’ll be using this stuff from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2023
K
Verified Purchase
Kylie
Charlottesville, US
★★★★★ 5
Excellent spray coverage
Size: 6 Fl Oz (Pack of 1)
Love how this sprays! It isn’t just a line like all other spray sunblock this has a wide nosal and covers more. Great product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
R
Verified Purchase
R Stepherson
Draper, US
★★★★★ 4
I am super white and have great skin which is super surprising ...
I just started using this product and I wanted to write because I thought some of the reviews were mixed when I read them. I used to use Zinka's spray but they changed their formula and now it is a greasy mess, that never dries do not buy that, I wrote the company and they do not care. First and foremost this bottle is heavy so I am not sure if the shaker ball is heavy or what but a 6oz bottle should not be this heavy so that might be a marketing ploy, hope I don't run out and just have a shaker ball. I am super white and have great skin which is super surprising as my childcare was being dumped off at the local pool in TX without sunscreen during the summers, but I attribute that to using a zinc based sunscreen for the past 10-15 years. I use this everyday, rain or shine as I live in TX and it never rains long and winter here has sunshine too. I use it on my face, hands and decolletage. Yes, my face, under my make up or not. Here are the issues, this makes a super white paste that does not fade into the skin if you go too heavy. So you have to rub it in and even then there is a whiteness, and I am already a white gal. I too am longing for a day of clear zinc sunscreen. But none on the market I have found that are not an oily mess that cause breakouts. I like the dry texture of this spray, and if I spray a thin layer I do not need to rub, so that is perfect for me on my face as most make up I put over it has spf protection anyways, so no problem there, and this stuff stays on 12 hours or more. I think the cost is high, I used to pay around $10 a bottle for zinka but it was not as heavy as this so I will see how long this lasts. But so far except for the cost and the having to rub it in I really like this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2016
M
Verified Purchase
Meeshu
Lexington, US
★★★★★ 5
My favorite sunscreen
Size: 6 Fl Oz (Pack of 1)
I love this sunscreen and have been carrying a can in my bag all this summer. To address a couple of common complaints: “It’s not sheer at all”: “Sheer” does not mean the same thing as “clear,” people. This spray is white and absolutely does rub in to be sheer as advertised. It leaves a slight (“sheer”) white tinge after rubbing in, but it’s not super noticeable on my pale skin. It might be more problematic on darker skin tones. (Also, it should be noted that there is literally no such thing as clear mineral sunscreen- you will have to choose between a product like this and a clear one containing endocrine disruptors. I’d rather look a little pasty, personally.) “My whole family used this and got burned”: You need to shake the can before spraying, as per the instructions. These sprays are made of zinc (the active, protective ingredient) in a liquid suspension. If you spray without shaking the can first, you risk getting all liquid and no zinc particles, and then yes, you will burn. I’m pretty sensitive and this sunscreen has not failed me yet. “It’s hard to get off”: This is true. It is hard to get off. But why would you want a sunscreen to come off easily?? This stuff is water resistant to an impressive degree. In the evening if it takes a vigorous scrubbing to get it off, I consider the exfoliation a bonus. Also, my nozzles have worked just fine and the cans last me quite a good amount of time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2019
A
Verified Purchase
AlliCat0420
Natrona Heights, US
★★★★★ 5
It really is water resistant
Size: 6 Fl Oz (Pack of 1)
This stuff is great. Normally when buying a green sunscreen, I have to sacrifice the aerosol feature and default to a lotion. This has a very neutral scent and sprays easily and evenly. It is zinc-based, so it will leave a white haze on your skin. I did need to rub it in after spraying, which helped minimize the white hue. It does love bathing suits, so be prepared to also rub the zinc powder into your bathing suit, otherwise it will be spray painted white. I used this while tubing and did not get burned--just nice and toasty-tan. The biggest downside is that it has a very slight stickiness/tackiness to it. I showered twice before I finally felt like it was all off my skin. But at least it didn't come off in the river!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2019

recommand products