SKU: 75680580801

Human Renin, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Renin, His TagProduct Specification Species Human Accession P00797 Amino Acid Sequence

Product Specification


Species Human
Accession P00797
Amino Acid Sequence

LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 44.0 kDa (reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

Renin, also known as angiotensinogen enzyme, is a proteolytic enzyme released by paraspheroidal granulosa cells and is part of the renin-angiotensin system. Renin acts on plasma angiotensingen to produce inactive angiotensin I, which is hydrolyzed to active angiotensin II under the action of angiotensin converting enzyme. Angiotensin II can cause arteriolar vasoconstriction and promote the synthesis and secretion of aldosterone in adrenal cortex. Plasma Renin activity test can be used to diagnose primary aldosteronism and hypertension.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75680580801

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Great box for traveling or your safe!
Color: Black
The Travel Jewelry Box is a must-have accessory for anyone who loves to accessorize on the go. This compact yet versatile organizer is the perfect solution for keeping your favorite jewelry safe, secure, and tangle-free while you travel. Let's start with the design. The Travel Jewelry Box is intelligently crafted to maximize space without sacrificing functionality. Despite its compact size, it features multiple compartments, pockets, and hooks to accommodate a variety of jewelry pieces. From earrings and rings to necklaces and bracelets, there's a dedicated spot for everything, ensuring that your jewelry stays organized and protected during transit. Durability is another standout feature of this jewelry box. Constructed from high-quality materials like faux leather or sturdy fabric, it's built to withstand the wear and tear of travel. The exterior provides a layer of protection against bumps and scratches, while the interior is lined with soft velvet or plush fabric to prevent your jewelry from getting damaged. One of the things I love most about the Travel Jewelry Box is its versatility. Whether you're jet-setting across the globe or simply heading out for a weekend getaway, this compact organizer is the perfect companion. It easily fits into your carry-on luggage, purse, or backpack, ensuring that your precious jewelry is always within reach. And with its sleek and stylish design, it adds a touch of elegance to your travel ensemble. But perhaps the best part about the Travel Jewelry Box is its practicality. It's designed with the traveler in mind, featuring thoughtful details like a secure zipper closure, removable compartments, and a compact size that fits easily into any travel bag. No more digging through tangled necklaces or searching for lost earrings – with this jewelry box, everything has its place, making it easy to find and access your favorite pieces whenever you need them. In conclusion, the Travel Jewelry Box is a game-changer for anyone who wants to travel in style without sacrificing the safety and organization of their jewelry. With its smart design, durability, versatility, and practicality, it's a must-have accessory for jet-setters, weekend warriors, and anyone in between. Trust me, once you experience the convenience of the Travel Jewelry Box, you'll wonder how you ever traveled without it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2024
B
Verified Purchase
Becca- Honest Vine Voice
Lake Worth, US
★★★★★ 4
Great travel jewelry case
Color: Black
Great colors. Good size. Easy to pack and carry. Fits a good amount of jewelry. It’s decent quality. I know there is better out there but for the value it’s great. It snaps close and I haven’t had mine accidentally come open at all. The inside is soft. My necklaces did get a little tangled inside but not too bad. I could have put them in there better. Very nice though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2025
K
Verified Purchase
Kristin
Grantham, US
★★★★★ 5
Store it all!
Color: Pink
This is a compact, light weight, efficient, and sturdy/convenient way to securely store jewelry. The small compact case allows jewelry from earrings to necklaces to bracelets and rings to be all together without being tangled and/or on top of each other. I have more earrings than rings so I used the ring area to store the rest of my earrings. The tight clasp allows the lid to be fasten snuggly to the body of the case. The price was right considering what other stores were charging. I chose the pink case which is a very soft pink, as like the case, but there are other colors to choose from. The case is mobile and would stand strong in a carry on case or bag. I highly recommend this item if you are looking to organize and have your jewelry neatly and safely all in one place!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
S
Verified Purchase
Shani
Houston, US
★★★★★ 5
Cute and super convenient for travel
Color: Black
Really happy with this jewelry box overall. It’s compact, lightweight, and perfect for travel. The compartments are well designed for rings, earrings, and even long bracelets, which fit really nicely. The only downside for me is the necklace section. When using multiple necklaces, they can get tangled, so it’s not the most practical part of the case. Other than that, it’s a great product for the price and looks very cute
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
J
Verified Purchase
Justme
Charlottesville, US
★★★★★ 5
Nice gift!
Color: Black
I got this as a gift for a coworker and it was cute compact and of good quality. I love the earring compartment for her because she always wears earrings and she travels, I figured it would be a great thing for her to have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026

recommand products