SKU: 89325493153

Biotinylated CTLA4 His&Avi Tag Protein, Human

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CTLA4 His&Avi Tag Protein, HumanProduct Specification Species Human Antigen CTLA4 Synonyms CTLA4,CD152 Accession P16410 Amino Acid Sequence Ala37 Phe162, with C terminal 8*His&Avi tag AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 20 27Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical

Product Specification


Species Human
Antigen CTLA4
Synonyms CTLA4,CD152
Accession P16410
Amino Acid Sequence

Ala37 - Phe162, with C-terminal 8*His&Avi tag

AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight

20-27Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Shuang Qin, Linping Xu, Ming Yi, Shengnan Yu,Kongming Wu & Suxia Luo: Novel immune checkpoint targets: moving beyondPD-1 and CTLA-4: MolecularCancer volume 18, Article number: 155 (2019).


Background

Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89325493153

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Annette B.
Louisville, US
★★★★★ 5
My Teenage Daughter Called Me Trendy!
Size: Medium, Color: Blue, Size: Medium, Color: Blue
My teenage daughter called me trendy! I’ll go with it!!! I feel confident and trendy wearing this pair of jeans. How could I not?!!! A cute drawstring weaved through the gourmet waist adds to the comfy causal style. The barrel legs have a small distressing on the legs. Darker faux patches added to the lighter wash jeans give a Friday vibe any day of the week. I love the functional large front and back pockets my phone and keys fit comfortably in my front pockets. I so happy with the quality and price of this pair of jeans! I highly recommend them!! I have worn the jeans to a few different events and always get asked where I got my jeans! Love them and you will too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025
A
Verified Purchase
Angela S.
West Palm Beach, US
★★★★★ 5
super cute
very adorable. I ordered a medium, at 160 who carries their weight in their butt and thighs they fit but are a little small waisted but can still button. Id still wear a bit to stretch them to my shape as a good day old pair of jeans fits. they're very cute and i love them. im not willing to go up a size lol cuz the tightness is all on me:)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2024
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 3
Cute but runs small
Size: Large, Color: Blue
I’m usually a large, but these pants were tight around my the hip/ bum area. And not as barrel as the picture showed. I’m 5’2” and the length was perfect. The drawstring serves zero purpose, just for looks. The color and patch work of the pants are so cute too. I will be exchanging for a size up so hopefully that helps
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2025
A
Verified Purchase
A. Walther
Grantham, US
★★★★★ 4
Get lots of compliments.
Size: X-Large, Color: Blue
These are awesome! I get lots of compliments. I took out the string/rope belt and just wear a regular belt because the rivets look cheap but it works.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
N
Verified Purchase
Neva
Battle Creek, US
★★★★★ 5
I got ripped off
Size: Large, Color: Blue
Loops were missing for belt. I returned for a different pair hoping it was a defect. Received another with the same problem. The denim ones have 6 loops. The white have only 4. So impossible to loop correctly. After I received the second pair they charged me for the ones I returned. So I paid for 2 pairs only kept one
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026

recommand products