Pay in installments of $75.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 15 - Jul 20
For Your Every Summer RSVP, with Code: SUMMER15
Description
IL10RB His Tag Protein, MouseProduct Specification Species Mouse Synonyms CDw210b, CRF2 4IL 10R subunit 2, CRFB4, CRFB4human transmembrane receptor protein, D21S58, D21S66, IBD25, IL 10 R beta, IL 10 receptor subunit beta, IL10R beta, IL 10R2, IL 10Rb Accession Q61190 Amino Acid Sequence Met20 Ser220, with C terminal 8*His
Product Specification
| Species | Mouse |
| Synonyms | CDw210b, CRF2-4IL-10R subunit 2, CRFB4, CRFB4human transmembrane receptor protein, D21S58, D21S66, IBD25, IL-10 R beta, IL-10 receptor subunit beta, IL10R beta, IL-10R2, IL-10Rb |
| Accession | Q61190 |
| Amino Acid Sequence | Met20-Ser220, with C-terminal 8*His MIPPPEKVRMNSVNFKNILQWEVPAFPKTNLTFTAQYESYRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVNVTFCPVEDTIIGPPEMQIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVVSPYDSEVLRNLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTGNDEITPSGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 30-43kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Lutfalla, G. et al. (1993) Genomics 16:366. 2.Xie, M.-H. et al. (2000) J. Biol. Chem. 275:31335. 3.Kotenko, S.V. et al. (2003) Nat. Immunol. 4:69. 4. Yoon, S.I. et al. (2006) J. Biol. Chem. 281:35088. |
Background
Interleukin 10 receptor, beta subunit (IL10RB/IL-10RB) also known as Cytokine receptor family 2 member 4, Interleukin-10 receptor subunit 2, and cytokine receptor family II, member 4, is a subunit for the interleukin-10 receptor. Some members of the IL-10 family are monomeric cytokines and interact with single molecules of IL-10 R beta and their ligand‑specific subunit. Mature human IL-10 R beta consists of a 201 amino acid (aa) extracellular region with two fibronectin type-III domains, a 22 aa transmembrane segment and a 83 aa cytoplasmic domain. IL‑10 R beta is widely expressed, while the associated receptor subunits exhibit differential expression patterns. The ligand‑specific subunits are responsible for the divergent functions of these cytokines, encompassing immune suppression, promotion or inhibition of inflammation, mucosal defense, antiviral immunity, and hematopoiesis. IL-10 R beta deficient mice lack responsiveness to each of those cytokines. IL-10 R beta contributes to ligand binding, but effective signaling is only triggered in the presence of the ligand‑specific subunit. In the case of IL-10, a cytokine dimer binds to two IL‑10 R alpha /IL-10R1 chains, resulting in recruitment of two IL-10 R beta /IL-10R2 chains.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy