SKU: 96542927932

Human 14-3-3 beta, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 14 - Jul 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human 14-3-3 beta, His tagProduct Specification Species Human Synonyms Protein 1054, Protein kinase C inhibitor protein 1 (KCIP 1) Accession P31946 Amino Acid Sequence Protein sequence (P31946, Met1 Asn246, with C 10*His)

Product Specification


Species Human
Synonyms Protein 1054, Protein kinase C inhibitor protein 1 (KCIP-1)
Accession P31946
Amino Acid Sequence

Protein sequence (P31946, Met1-Asn246, with C-10*His) MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGENGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 29.8 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein beta/alpha is a protein that in humans is encoded by the YWHAB gene. This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. It has been documented to regulate various cellular processes, including cell proliferation, signal transduction, cell cycle and apoptosis. Downregulation of YWHAB has been reported to impart suppressive effects on the proliferation of cervical and gastric cancer cells. Additionally, YWHAB was previously found to be upregulated in colon cancer cells, which is in turn associated with poorer prognosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96542927932

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1729 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tom
Houston, US
★★★★★ 5
Perfect diapers -soft,absorbent,and no leaks!
Size: Size 6, Unit Count: 48
These Pampers diapers are amazing! The material is very soft and comfortable for my baby. They have great absorbency and can last through the night without any leaks. I also noticed no rashes or irritation, which is very important to me. The fit is perfect and easy to put on. Definitely one of the best diapers I’ve used. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
E
Verified Purchase
Eleventh Street Beauty
Pawtucket, US
★★★★★ 5
Mom of 6 approved
Size: Size 3, Unit Count: 78
I'm a mom of 6 and these are the best diapers. No problems. Extremely soft and comfy. Easiest diaper to get on a toddler doing the alligator roll. I put my hands through the leg holes and grab their feet to pull them through for easiest pull on. No problems with blow outs. I love the new tear off feature, so no issue with getting them off. I get them on subscription on Amazon to save money and get the big pack.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
S
Verified Purchase
Su
Los Angeles, US
★★★★★ 5
Recommended
Size: Size 5, Unit Count: 100
I absolutely love these Pampers Cruisers 360 Size 5 diapers! As a parent of an active toddler, diaper changes used to be such a struggle—but these have made a huge difference. The pull-on style is a game changer. I can quickly put them on even when my child is moving around, and the 360° stretchy waistband fits snugly without being too tight. It really feels like little “training pants,” which is great as we slowly move toward potty training. What impressed me the most is how leak-proof and absorbent they are. Even during long days or naps, they keep my child dry and comfortable. The material is also very soft and gentle on the skin, and we haven’t had any irritation or rashes at all. (They’re actually designed to be gentle and hypoallergenic, which gives extra peace of mind.) I also love the easy tear-away sides and disposal tape—it makes cleanup so quick and mess-free. Overall, these diapers are perfect for active toddlers. Comfortable, reliable, and super convenient—I highly recommend them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
Verified Purchase
Altamirano
Cuba, US
★★★★★ 5
It's worth it.
Size: Size 7, Unit Count: 44, Size: Size 7, Unit Count: 44
I would like to provide feedback regarding a recent diaper experience. My toddler, who has a tendency to remove his diaper, has previously used Parent's Choice products since birth without issue. However, I have recently encountered a problem with both their standard diapers and Pull-Ups, specifically concerning the coverage in the gluteal region. This has led to the diaper riding up and causing a significant rash due to friction. I am pleased to report that after two hours of use, the current diaper has exceeded my expectations. My son has not removed it, and the coverage in the gluteal area is excellent. I will provide an update should any leakage occur. I also appreciate the baby powder scent and the overall quality of the product. While the price point is slightly higher than I typically prefer for diapers, my son is approaching three years old and will soon be transitioning to potty training.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
Y
Verified Purchase
Yela
Lake Worth, US
★★★★★ 5
Movement freedom and quick changes: The ideal diaper for active babies
Size: Size 5, Unit Count: 56, Size: Size 5, Unit Count: 56
360° Flexible Fit: The standout feature is the 360° stretchy waistband that adapts perfectly to the baby's body, preventing gaps and allowing full, unrestricted movement. • Easy On and Off: Being a "Pull-On" style, it slides up in a second. For removal, it features the practical "e-z off" tabs on the sides that tear easily for a hygienic and fast change. • Designed for Active Babies: The packaging highlights an All-Around Fit specifically engineered for dynamic little ones who need protection that keeps up with them. If your baby has started moving and diaper changes have become a 'wrestling match' with traditional tabs, Pampers Cruisers 360° are the ultimate solution. They offer the peace of mind of Pampers protection with the convenience of pull-up underwear. A great investment for your child's exploration stage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026

recommand products